Product Sheet RP2060
Product Sheet RP2060AF
Description
BACKGROUND Interleukin-17E (IL-17E), also commonly called IL-25, is a pro-inflammatory cytokine member of a six-species family of proteins (IL-17A-17F). IL-17F stimulates secretion of IL-8 and induces activation of NF-_B by binding to the receptor IL-17RB.
Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer. It contains two 145 amino acid peptides and has a total molecular mass of 35.5 kDa.
Products are for research use only. They are not intended for human, animal, or diagnostic applications.
Details
Cat. No.:
RP2060 / R2060AF
Alternative Name:
IL-25
Source:
E. coli
Physical Appearance:
Sterile Filtered white lyophilized (freeze-dried) powder.
Formulation:
Recombinant mouse IL-17E is lyophilized with no additives.
Stability:
Lyophilized product is very stable at -20°C. Reconstituted material should be aliquoted and frozen at -20°C. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
Reconstitution:
Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile 10 mM HCl at a concentration of 0.1 mg/ml before further dilutions into other buffers can be made.
Protein Content and Purity determined by:
UV spectroscopy at 280 nm.
RP-HPLC calibrated against a known standard.
Quantitation against a known standard via reducing and non-reducing SDS-PAGE gels.
RP-HPLC calibrated against a known standard.
Quantitation against a known standard via reducing and non-reducing SDS-PAGE gels.
Endotoxin Level:
Endotoxin level, as measured by LAL analysis, is <0.01ng/ug or <0.1EU/ug.
Biological Activity:
The activity is calculated by the dose-dependant induction of IL-8 release from cultured human PBMCs and is typically 10-100 ng/mL.
AA Sequence:
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Animal Component-Free
This product is produced with no animal derived raw products. All processing and handling employs animal free equipment and animal free protocols.
Products
| Product | Size | CAT.# | Price | Quantity |
|---|---|---|---|---|
| Mouse Interleukin-17E (IL-25): Mouse Interleukin-17E | Size: 25 ug | CAT.#: RP2060-25 | Price: $194.00 | |
| Mouse Interleukin-17E (IL-25): Mouse Interleukin-17E | Size: 100 ug | CAT.#: RP2060-100 | Price: $484.00 | |
| Mouse Interleukin-17E (IL-25): Mouse Interleukin-17E | Size: 1000 ug | CAT.#: RP2060-1000 | Price: $3,175.00 | |
| Mouse IL-17E (IL-25), Animal-Free: Mouse IL-17E, Animal-Free | Size: 25 ug | CAT.#: RP2060AF-25 | Price: $213.00 | |
| Mouse IL-17E (IL-25), Animal-Free: Mouse IL-17E, Animal-Free | Size: 100 ug | CAT.#: RP2060AF-100 | Price: $533.00 | |
| Mouse IL-17E (IL-25), Animal-Free: Mouse IL-17E, Animal-Free | Size: 1000 ug | CAT.#: RP2060AF-1000 | Price: $3,492.00 |