Product Sheet RP2075
Product Sheet RP2075AF
Description
BACKGROUND Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNFα) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Recombinant mouse Interleukin-19 is a non-glycosylated protein monomer, containing 153 amino acids and having a molecular mass of 17.7 kDa.
Products are for research use only. They are not intended for human, animal, or diagnostic applications.
Details
Cat. No.:
RP2075 / RP2075AF
Source:
E. coli
Physical Appearance:
Sterile Filtered white lyophilized (freeze-dried) powder.
Formulation:
10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Stability:
Lyophilized product is very stable at -20°C. Reconstituted material should be aliquoted and frozen at -20°C. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
Reconstitution:
Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at 0.1 mg/mL, which can be further diluted into other aqueous solutions.
Protein Content and Purity determined by:
• UV spectroscopy at 280 nm.
• RP-HPLC calibrated against a known standard.
• Quantitation against a known standard via reducing and non-reducing SDS-PAGE gels.
Endotoxin Level:
Endotoxin level, as measured by LAL analysis, is <0.01ng/ug or <0.1EU/ug.
AA Sequence:
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Animal Component-Free
This product is produced with no animal derived raw products. All processing and handling employs animal free equipment and animal free protocols.
Products
| Product | Size | CAT.# | Price | Quantity |
|---|---|---|---|---|
| Mouse Interleukin-19 (IL-19): Mouse Interleukin-19 | Size: 10 ug | CAT.#: RP2075-10 | Price: $195.00 | |
| Mouse Interleukin-19 (IL-19): Mouse Interleukin-19 | Size: 100 ug | CAT.#: RP2075-100 | Price: $682.00 | |
| Mouse Interleukin-19 (IL-19): Mouse Interleukin-19 | Size: 1000 ug | CAT.#: RP2075-1000 | Price: $5,640.00 | |
| Mouse IL-19, Animal-Free: Mouse IL-19, Animal-Free | Size: 10 ug | CAT.#: RP2075AF-10 | Price: $215.00 | |
| Mouse IL-19, Animal-Free: Mouse IL-19, Animal-Free | Size: 100 ug | CAT.#: RP2075AF-100 | Price: $746.00 | |
| Mouse IL-19, Animal-Free: Mouse IL-19, Animal-Free | Size: 1000 ug | CAT.#: RP2075AF-1000 | Price: $6,204.00 |